PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc02440.1.g00130.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 644aa    MW: 69155.1 Da    PI: 8.6125
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc02440.1.g00130.1.sm.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_142.91e-13119180162
                                     XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                          bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                                     e e kr  r+ +NRe+A  sRqRKk+++eeLe kv +++a   +L  +++  + e a+lk +
  Zpz_sc02440.1.g00130.1.sm.mkhc 119 EDEAKRRARLVRNRESAHLSRQRKKQYVEELEGKVNAMQATIADLSARISCVTAENAALKEQ 180
                                     5789*****************************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF001703.4E-12119180IPR004827Basic-leucine zipper domain
SMARTSM003385.8E-14119183IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.105121181IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1705.9E-16123181No hitNo description
SuperFamilySSF579596.88E-13123181No hitNo description
CDDcd147041.01E-19124175No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 644 aa     Download sequence    Send to blast
MSEPSLLAPV AQDPFADLSF PELQVPPVDD TFAFEDFNLD DLDLDVDFDL DLFAADGQLS  60
QPPPLATSSS SAPSPERGSS SSSAGGDGGL RNEDSSESSS RSATGKDSCG KGKGDGAEED  120
EAKRRARLVR NRESAHLSRQ RKKQYVEELE GKVNAMQATI ADLSARISCV TAENAALKEQ  180
LGGATGGAPP PLPMYPAVYP LLMPLVHPAY AMRGSQVPLV PIPRLKFQQP TPASEPPAKK  240
PRKTKKVASV SLLGLLCLVM VCRCLIPAVN RMYGTTDTGE GFAFGPSHHH GRVLAVEGPS  300
NSVLEGTDPK PPKNASETLP ALLYLPRNGK HVKINGNLVI KSIVASEEAS RMSRYDEKSH  360
RSQRKEETSL AIPGNMAPLE AGEAVEPTAE VKNKLMALAP GDANMYREDD GLIPQWFSEA  420
MSGPMLSPGM CTEVFQFDVS SSSTHANGIV PVYSNSMANS SQNFTGNLPS GQPQKVKNRR  480
ILYSGAIPLK GSTSNVTEHL KAHPKNETYA RSKPVSSMVV SILADPREAG DRSSDGRISS  540
KSLSRKGSKL SYWPIGLVGI KADSQTRHEA HLLAHCLGGY RSPLTDQAHQ HWMRKGQTTT  600
SPNPWVPPNI NLRLRMSASS AFRFSSPATR PTGLAPQGRY HIGA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002461117.10.0hypothetical protein SORBIDRAFT_02g041070
TrEMBLA0A0K0K9Y40.0A0A0K0K9Y4_ELECO; BZIP transcription factor b
STRINGSb02g041070.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP111793035
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.14e-63bZIP family protein